Package: surveytidy 0.6.1

surveytidy: Tidy 'dplyr'/'tidyr' Verbs for Survey Design Objects

Provides 'dplyr' and 'tidyr' verbs, survey-aware recoding helpers, and row-wise statistics for survey design objects created with the 'surveycore' package. filter() uses domain estimation to preserve variance estimation validity; other verbs preserve design variables and metadata automatically. Also supports survey_collection objects for applying the same operation across a list of surveys.

Authors:Jacob Dennen [aut, cre, cph]

surveytidy_0.6.1.tar.gz
surveytidy_0.6.1.zip(r-4.7)surveytidy_0.6.1.zip(r-4.6)surveytidy_0.6.1.zip(r-4.5)
surveytidy_0.6.1.tgz(r-4.6-any)surveytidy_0.6.1.tgz(r-4.5-any)
surveytidy_0.6.1.tar.gz(r-4.7-any)surveytidy_0.6.1.tar.gz(r-4.6-any)
surveytidy_0.6.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html
card.svg |card.png
surveytidy/json (API)
NEWS

# Install 'surveytidy' in R:
install.packages('surveytidy', repos = c('https://jdenn0514.r-universe.dev', 'https://cloud.r-project.org'))

Bug tracker:https://github.com/jdenn0514/surveytidy/issues

Pkgdown/docs site:https://jdenn0514.github.io

On CRAN:

Conda:

data-cleaningsurvey-analysis

3.60 score 1 scripts 257 downloads 50 exports 41 dependencies

Last updated from:706d563520. Checks:9 OK. Indexed: yes.

TargetResultTimeFilesSyslog
linux-devel-x86_64OK247
source / vignettesOK247
linux-release-x86_64OK240
macos-release-arm64OK184
macos-oldrel-arm64OK223
windows-develOK263
windows-releaseOK256
windows-oldrelOK257
wasm-releaseOK122

Exports:add_surveyanti_joinarrangeas_survey_collectionbind_colsbind_rowscase_whendistinctdrop_nafilterfilter_outfull_joinglimpsegroup_bygroup_varsif_elseinner_joinis_groupedis_rowwiseleft_joinmake_binarymake_dichomake_factormake_flipmake_revmutatena_ifpullrecode_valuesrelocateremove_surveyrenamerename_withreplace_valuesreplace_whenright_joinrow_meansrow_sumsrowwiseselectsemi_joinset_collection_idset_collection_if_missing_varsliceslice_headslice_maxslice_minslice_sampleslice_tailungroup

Dependencies:backportsbitbit64checkmateclicliprcpp11crayondata.tabledplyrforcatsFormulagenericsgluehavenhmsinsightlifecyclemagrittrmarginaleffectspbivnormpillarpkgconfigprettyunitsprogresspurrrR6readrrlangS7stringistringrsurveycoretibbletidyrtidyselecttzdbutf8vctrsvroomwithr

Readme and manuals

Help Manual

Help pageTopics
Order rows using column valuesarrange arrange.survey_base arrange.survey_collection arrange.survey_result
Append columns to a survey design by positionbind_cols
Stack surveys with bind_rows (errors unconditionally)bind_rows
A generalised vectorised if-elsecase_when
Remove duplicate rows from a survey design objectdistinct distinct.survey_base distinct.survey_collection
Mark rows with missing values as out-of-domaindrop_na drop_na.survey_base drop_na.survey_collection drop_na.survey_result
Keep or drop rows using domain estimationfilter filter.survey_base filter.survey_collection filter.survey_result filter_out.survey_base filter_out.survey_collection
Get a glimpse of a survey design objectglimpse glimpse.survey_base glimpse.survey_collection
Group and ungroup a survey design objectgroup_by group_by.survey_base group_by.survey_collection ungroup.survey_base ungroup.survey_collection
Vectorised if-elseif_else
Domain-aware inner join for survey designsinner_join inner_join.survey_collection
Test whether a survey design has active groupingis_grouped
Test whether a survey design is in rowwise modeis_rowwise
Add columns from a data frame to a survey designleft_join left_join.survey_collection
Convert a dichotomous variable to a numeric 0/1 indicatormake_binary
Collapse a multi-level factor to two levelsmake_dicho
Convert a vector to a factor using value labelsmake_factor
Flip the semantic valence of a variablemake_flip
Reverse the numeric values of a scale variablemake_rev
Create, modify, and delete columns of a survey design objectmutate mutate.survey_base mutate.survey_collection mutate.survey_result
Convert values to 'NA'na_if
Extract a column from a survey design objectpull pull.survey_base pull.survey_collection
Recode values using an explicit mappingrecode_values
Change column order in a survey design objectrelocate relocate.survey_base relocate.survey_collection
Rename columns of a survey design objectrename rename.survey_base rename.survey_collection rename.survey_result rename_with.survey_base rename_with.survey_collection rename_with.survey_result
Partially update values using an explicit mappingreplace_values
Partially update a vector using conditional formulasreplace_when
Unsupported joins for survey designsfull_join full_join.survey_collection right_join right_join.survey_collection
Compute row-wise means across selected columnsrow_means
Compute row-wise sums across selected columnsrow_sums
Compute row-wise on a survey design objectrowwise rowwise.survey_base rowwise.survey_collection
Keep or drop columns using their names and typesselect select.survey_base select.survey_collection select.survey_result
Domain-aware semi- and anti-join for survey designsanti_join anti_join.survey_collection semi_join semi_join.survey_collection
Physically select rows of a survey design objectslice slice.survey_base slice.survey_collection slice.survey_result slice_head.survey_base slice_head.survey_collection slice_head.survey_result slice_max.survey_base slice_max.survey_collection slice_max.survey_result slice_min.survey_base slice_min.survey_collection slice_min.survey_result slice_sample.survey_base slice_sample.survey_collection slice_sample.survey_result slice_tail.survey_base slice_tail.survey_collection slice_tail.survey_result
Physically remove rows from a survey design objectsubset.survey_base