Package: surveytidy 0.6.1

surveytidy: Tidy 'dplyr'/'tidyr' Verbs for Survey Design Objects
Provides 'dplyr' and 'tidyr' verbs, survey-aware recoding helpers, and row-wise statistics for survey design objects created with the 'surveycore' package. filter() uses domain estimation to preserve variance estimation validity; other verbs preserve design variables and metadata automatically. Also supports survey_collection objects for applying the same operation across a list of surveys.
Authors:
surveytidy_0.6.1.tar.gz
surveytidy_0.6.1.zip(r-4.7)surveytidy_0.6.1.zip(r-4.6)surveytidy_0.6.1.zip(r-4.5)
surveytidy_0.6.1.tgz(r-4.6-any)surveytidy_0.6.1.tgz(r-4.5-any)
surveytidy_0.6.1.tar.gz(r-4.7-any)surveytidy_0.6.1.tar.gz(r-4.6-any)
surveytidy_0.6.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
card.svg |card.png
surveytidy/json (API)
NEWS
| # Install 'surveytidy' in R: |
| install.packages('surveytidy', repos = c('https://jdenn0514.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/jdenn0514/surveytidy/issues
Pkgdown/docs site:https://jdenn0514.github.io
Last updated from:706d563520. Checks:9 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 247 | ||
| source / vignettes | OK | 247 | ||
| linux-release-x86_64 | OK | 240 | ||
| macos-release-arm64 | OK | 184 | ||
| macos-oldrel-arm64 | OK | 223 | ||
| windows-devel | OK | 263 | ||
| windows-release | OK | 256 | ||
| windows-oldrel | OK | 257 | ||
| wasm-release | OK | 122 |
Exports:add_surveyanti_joinarrangeas_survey_collectionbind_colsbind_rowscase_whendistinctdrop_nafilterfilter_outfull_joinglimpsegroup_bygroup_varsif_elseinner_joinis_groupedis_rowwiseleft_joinmake_binarymake_dichomake_factormake_flipmake_revmutatena_ifpullrecode_valuesrelocateremove_surveyrenamerename_withreplace_valuesreplace_whenright_joinrow_meansrow_sumsrowwiseselectsemi_joinset_collection_idset_collection_if_missing_varsliceslice_headslice_maxslice_minslice_sampleslice_tailungroup
Dependencies:backportsbitbit64checkmateclicliprcpp11crayondata.tabledplyrforcatsFormulagenericsgluehavenhmsinsightlifecyclemagrittrmarginaleffectspbivnormpillarpkgconfigprettyunitsprogresspurrrR6readrrlangS7stringistringrsurveycoretibbletidyrtidyselecttzdbutf8vctrsvroomwithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Order rows using column values | arrange arrange.survey_base arrange.survey_collection arrange.survey_result |
| Append columns to a survey design by position | bind_cols |
| Stack surveys with bind_rows (errors unconditionally) | bind_rows |
| A generalised vectorised if-else | case_when |
| Remove duplicate rows from a survey design object | distinct distinct.survey_base distinct.survey_collection |
| Mark rows with missing values as out-of-domain | drop_na drop_na.survey_base drop_na.survey_collection drop_na.survey_result |
| Keep or drop rows using domain estimation | filter filter.survey_base filter.survey_collection filter.survey_result filter_out.survey_base filter_out.survey_collection |
| Get a glimpse of a survey design object | glimpse glimpse.survey_base glimpse.survey_collection |
| Group and ungroup a survey design object | group_by group_by.survey_base group_by.survey_collection ungroup.survey_base ungroup.survey_collection |
| Vectorised if-else | if_else |
| Domain-aware inner join for survey designs | inner_join inner_join.survey_collection |
| Test whether a survey design has active grouping | is_grouped |
| Test whether a survey design is in rowwise mode | is_rowwise |
| Add columns from a data frame to a survey design | left_join left_join.survey_collection |
| Convert a dichotomous variable to a numeric 0/1 indicator | make_binary |
| Collapse a multi-level factor to two levels | make_dicho |
| Convert a vector to a factor using value labels | make_factor |
| Flip the semantic valence of a variable | make_flip |
| Reverse the numeric values of a scale variable | make_rev |
| Create, modify, and delete columns of a survey design object | mutate mutate.survey_base mutate.survey_collection mutate.survey_result |
| Convert values to 'NA' | na_if |
| Extract a column from a survey design object | pull pull.survey_base pull.survey_collection |
| Recode values using an explicit mapping | recode_values |
| Change column order in a survey design object | relocate relocate.survey_base relocate.survey_collection |
| Rename columns of a survey design object | rename rename.survey_base rename.survey_collection rename.survey_result rename_with.survey_base rename_with.survey_collection rename_with.survey_result |
| Partially update values using an explicit mapping | replace_values |
| Partially update a vector using conditional formulas | replace_when |
| Unsupported joins for survey designs | full_join full_join.survey_collection right_join right_join.survey_collection |
| Compute row-wise means across selected columns | row_means |
| Compute row-wise sums across selected columns | row_sums |
| Compute row-wise on a survey design object | rowwise rowwise.survey_base rowwise.survey_collection |
| Keep or drop columns using their names and types | select select.survey_base select.survey_collection select.survey_result |
| Domain-aware semi- and anti-join for survey designs | anti_join anti_join.survey_collection semi_join semi_join.survey_collection |
| Physically select rows of a survey design object | slice slice.survey_base slice.survey_collection slice.survey_result slice_head.survey_base slice_head.survey_collection slice_head.survey_result slice_max.survey_base slice_max.survey_collection slice_max.survey_result slice_min.survey_base slice_min.survey_collection slice_min.survey_result slice_sample.survey_base slice_sample.survey_collection slice_sample.survey_result slice_tail.survey_base slice_tail.survey_collection slice_tail.survey_result |
| Physically remove rows from a survey design object | subset.survey_base |
